PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn210521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family B3
Protein Properties Length: 933aa    MW: 105232 Da    PI: 6.1526
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn210521genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.31.9e-152791699
                EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
          B3 16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                l++p +f+++++g+   + +++l+d+ g+ W v+   +   +++++++GW++F++++ L+ g f+vF+ +++s+f   vk+f +
  Achn210521  2 LRVPPDFVKNFNGI--IPNKIILKDLGGKFWHVET--EEDENGVFFKNGWQRFASDHSLELGNFIVFRCNRNSSF--DVKIFGN 79
                789*****888777..5668***************..*******************************9888999..9999865 PP

2B347.43.5e-151922641590
                 -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
          B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                 rl +pk+f++++g+k  e+ +++l++++g+ W v +++ k++ +++l+kGW +F k+ngL   D ++F+++ r+++
  Achn210521 192 RLNIPKDFLDKYGIKM-EP-EMVLRNQEGKLWPVDVTFPKNG-QITLSKGWMDFQKENGLGFDDKCIFEFVFRRGR 264
                 699*********8774.44.9***************887775.789***********************6644333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.09E-15177No hitNo description
SuperFamilySSF1019364.32E-20182IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.622180IPR003340B3 DNA binding domain
SMARTSM010194.9E-7180IPR003340B3 DNA binding domain
PfamPF023622.5E-13278IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-19282IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.49E-20174261IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.5E-19174277IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.69178278IPR003340B3 DNA binding domain
CDDcd100174.29E-15179276No hitNo description
SMARTSM010199.4E-16181278IPR003340B3 DNA binding domain
PfamPF023621.9E-12192265IPR003340B3 DNA binding domain
PfamPF048841.9E-26684788IPR006968Root UVB sensitive family
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MLRVPPDFVK NFNGIIPNKI ILKDLGGKFW HVETEEDENG VFFKNGWQRF ASDHSLELGN  60
FIVFRCNRNS SFDVKIFGNN GCMKEEDLAY KCVNEEIPAA EKTAIPVKND EESEEVDTSP  120
KPTRNFKRKY SEVNMKRSEK TGGTGSNAVS RRKSPRIGSK TIEQHGTFDS SEFSKPTNPH  180
FVASIQPASF YRLNIPKDFL DKYGIKMEPE MVLRNQEGKL WPVDVTFPKN GQITLSKGWM  240
DFQKENGLGF DDKCIFEFVF RRGRRLSREI QVRILRATEN KIPSGVIVMD LQLKVIAVAE  300
EGGEIRSEMK GPKSVFGYIC YFIFFIPVFF LLCGVGLYKV VLAIIVGILS SFGYGCYAAV  360
VAYQESSTWR GLLYVVASAA LFDEYTNDLL YLREGSCFPS LHEQHEGLHG EEPLIGPPSV  420
KTKTLQAVVI WDGFIKGCGD IGKELLRVGA IGIADLDAWK ESRNKIVNIG IPAYAFLECF  480
LYSIKSGSPG FLLRDNVEIT HVNRPEGRIF DWLYEPMSIM KEQIRRLNLE ASEELYFYKY  540
CLYSGDASRI ESWQNGGVPP QDEIKRAQLE GIARRLQGFC LTLSRMPTSR RRFFEVVKAI  600
EQEEESLGGL RGGNDGIEAD EKLENLDEPT SPLRLPVVIR RPGSVFRYLW DGNELNLVSV  660
DGNALSFSRE NFCLDFEDGF WRLVQICGSR AMFRAIGVGY SRSLPSAAAL NWVLKDGLGR  720
LSRCIYTASL ASAFDINLKR VRFSTSVLFS LSLGVELLTP AFPQYFLLLA SVANIAKQIS  780
LACYLATGDR LEIIINTWIQ FGNVPSPAEV SKEEGIDFLW TKVFVSVADL QQGILLCLRE  840
GVGTADVIMG LLQACHIRKA ILSSRCKWEN ISEACGSYDL VMRDWLKLNE DSKQCAQREF  900
NFLNEQMLGL GWACKNILLS TQEQERYSFV DD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37792244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.12e-33B3 family protein